LL-37

🧬 LL-37 Peptide – Antimicrobial and Immunomodulatory Research Peptide

1. Overview

LL-37 is a naturally occurring antimicrobial peptide derived from the human cathelicidin protein (hCAP18). It is a key component of the innate immune system, helping protect the body against bacteria, viruses, and fungi. In research, LL-37 is valued for its antimicrobial, anti-inflammatory, and tissue-repair properties, making it a common focus in microbiology, immunology, wound healing, and inflammation studies.

Important: LL-37 peptide is strictly for laboratory research and is not approved for therapeutic or clinical use.

2. Peptide Profile

• Peptide Name: LL-37 (Human Cathelicidin)
• Sequence: [LL-37, 37 aa]
• Molecular Formula: C₂₀₃H₃₁₈N₅₆O₄₀
• Molecular Weight: ~4493.3 g/mol
• Appearance: White/off-white lyophilized powder
• Purity: ≥98% (HPLC verified)
• Solubility: Water, PBS, or mild acetic acid
• Storage: −20°C, dry, light-protected
• Shelf Life: 24 months (lyophilized)

3. Mechanism of Action

LL-37 demonstrates both direct antimicrobial activity and immune system modulation:

a) Antimicrobial Effects

• Disrupts bacterial cell membranes, causing cell lysis
• Effective against gram-positive and gram-negative bacteria, fungi, and some viruses

b) Immune Modulation

• Regulates cytokine release
• Activates macrophages and neutrophils
• Supports tissue repair and angiogenesis

c) Tissue Healing

• Stimulates keratinocyte migration
• Promotes collagen synthesis
• Enhances vascular repair and epithelial closure

4. Research Applications

LL-37 is widely studied in laboratory settings for its versatile properties:

1. Antimicrobial Research: Exploring bacterial resistance and innate immune responses
2. Immune System Modulation: Investigating cytokine balance and inflammatory pathways
3. Wound Healing & Regeneration: Supporting tissue repair, collagen production, and angiogenesis
4. Inflammatory Models: Studying chronic inflammation and autoimmune responses
5. Biofilm & Microbial Defense: Evaluating anti-biofilm activity and microbial control

Note: All research is preclinical. LL-37 is not intended for human use.

5. Advantages in Research

6. Handling and Storage

• Store lyophilized powder at −20°C, dry, and light-protected
• Reconstitute in sterile water or PBS
• Avoid repeated freeze–thaw cycles
• Label clearly: “For Research Use Only – Not for Human Use”

7. Sourcing High-Quality LL-37

To ensure consistency and reproducibility:

• Purity ≥98% (verified by HPLC or LC-MS)
• Include Certificate of Analysis (COA) for every batch
• Use temperature-controlled shipping
• Source from reputable suppliers with transparent synthesis methods

8. FAQs

Q1. What is LL-37 peptide?
A: A human cathelicidin-derived peptide with antimicrobial and immune-regulating properties used in research.

Q2. Can LL-37 be used therapeutically?
A: No. It is strictly for laboratory and research use.

Q3. How should LL-37 be stored?
A: −20°C, dry and protected from light.

Q4. What research areas is LL-37 used for?
A: Antimicrobial studies, immune modulation, wound healing, inflammation, and biofilm research.

9. Summary

LL-37 peptide is a versatile research tool combining antimicrobial activity, immune regulation, and tissue-repair properties. Its synthetic form allows precise, reproducible experiments in microbiology, immunology, and regenerative medicine research.

Disclaimer: LL-37 peptide is for laboratory research only. Not for human or veterinary use.